DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and gbx1

DIOPT Version :9

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_777286.1 Gene:gbx1 / 142985 ZFINID:ZDB-GENE-020117-2 Length:316 Species:Danio rerio


Alignment Length:163 Identity:42/163 - (25%)
Similarity:60/163 - (36%) Gaps:50/163 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRR 150
            :.||......:.||.||.|||.|:.|||:.|...:||:....:.::..|.|...||||||:|||.
Zfish   203 DALPPGGSAGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRA 267

  Fly   151 RHK-IQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHMTEHY 214
            :.| |::....::|              |:|.          ..|..:.|.|.            
Zfish   268 KWKRIKAGNVNNRS--------------GEPV----------RNPKIVVPIPV------------ 296

  Fly   215 SESFNAYYNYNGGHNHAQANRHMHMQYPSGGGP 247
                         |.:..|.|..|.|...|..|
Zfish   297 -------------HVNRFAVRSQHQQIEPGSRP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeobox 106..153 CDD:278475 19/46 (41%)
gbx1NP_777286.1 Homeobox 217..270 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.