DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and HAT22

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_195493.1 Gene:HAT22 / 829935 AraportID:AT4G37790 Length:278 Species:Arabidopsis thaliana


Alignment Length:132 Identity:35/132 - (26%)
Similarity:52/132 - (39%) Gaps:37/132 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTR 119
            ||....||       .||.|        ||.:.....|.:...|..|...||:.||.:..|...:
plant   103 TTERVVCS-------RVSDD--------HDDEEGVSARKKLRLTKQQSALLEDNFKLHSTLNPKQ 152

  Fly   120 RIEIAQRLSLCERQVKIWFQNRRMKFK----------------------KDIQGHREPKSNAKLA 162
            :..:|::|:|..|||::||||||.:.|                      :.:|...:.....||:
plant   153 KQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLKALKLS 217

  Fly   163 QP 164
            ||
plant   218 QP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 19/52 (37%)
HAT22NP_195493.1 Homeobox 129..179 CDD:278475 19/49 (39%)
HALZ 181..224 CDD:128634 5/39 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.