DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and HB6

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:253 Identity:56/253 - (22%)
Similarity:98/253 - (38%) Gaps:58/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PTTLNDHCSP--------QHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFK 110
            |||..|..||        |.:.:.:...:|.:..:..|    |.|...:...:..|:..||..|:
plant    19 PTTSTDEQSPRRYGGREFQSMLEGYEEEEEAIVEERGH----VGLSEKKRRLSINQVKALEKNFE 79

  Fly   111 SNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAH---- 171
            ....|...|::::||.|.|..|||.:||||||.::|.     ::.:.:..:.:.|.:...|    
plant    80 LENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKT-----KQLEKDYGVLKTQYDSLRHNFDS 139

  Fly   172 -----RGIVKRLMSY---------SQDPREGTAAAEKRPMMAV-------------APVNPKPDY 209
                 ..:::.:...         .::..|..||......::|             ||.:| |.:
plant   140 LRRDNESLLQEISKLKTKLNGGGGEEEEEENNAAVTTESDISVKEEEVSLPEKITEAPSSP-PQF 203

  Fly   210 QASQKMKTEASTNNGMCSSADLSEI--LEHLAQTTAAPQVSTATSSTGTSTNSASSSS 265
                   .|.|......|..||.::  |:..|.:.||...|:.:|.:....|..|||:
plant   204 -------LEHSDGLNYRSFTDLRDLLPLKAAASSFAAAAGSSDSSDSSALLNEESSSN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 19/52 (37%)
HB6NP_565536.1 Homeobox 62..115 CDD:278475 19/52 (37%)
HALZ 117..158 CDD:280364 2/40 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.