DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and HB21

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_179445.1 Gene:HB21 / 816370 AraportID:AT2G18550 Length:220 Species:Arabidopsis thaliana


Alignment Length:228 Identity:46/228 - (20%)
Similarity:76/228 - (33%) Gaps:63/228 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VHQQHVSSDENL------------PSQPNHDSQRVKLKRSRTAFTSVQLVE-------------- 104
            ::.|:| .|.||            |..|....:....:|.:....||.:.|              
plant     1 MNNQNV-DDHNLLLISQLYPNVYTPLVPQQGGEAKPTRRRKRKSKSVVVAEEGENEGNGWFRKRK 64

  Fly   105 --------LENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFK-KDIQGHREPKSNA- 159
                    ||..|:.:..|...|:..:|..|.|..|||.:||||||.::| |.::.......|| 
plant    65 LSDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKRVEDEYTKLKNAY 129

  Fly   160 -----------------KLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAVAPVNPKP 207
                             |....:||:...| :.||:        |||.:............|...
plant   130 ETTVVEKCRLDSEVIHLKEQLYEAEREIQR-LAKRV--------EGTLSNSPISSSVTIEANHTT 185

  Fly   208 DYQASQKMKTEASTNNGMCSSADLSEILEHLAQ 240
            .:.....:..:...:..:..|.|..:.|:.::|
plant   186 PFFGDYDIGFDGEADENLLYSPDYIDGLDWMSQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 20/74 (27%)
HB21NP_179445.1 HOX 61..114 CDD:197696 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.