DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Abd-B

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster


Alignment Length:147 Identity:51/147 - (34%)
Similarity:74/147 - (50%) Gaps:26/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PPNYNQMNSNPTTLNDHCSPQHVHQQHVSSDEN--------LPSQPN---HD-SQRVKLKRSRTA 96
            ||.|    |:|..|..:.|     :.:.||..:        .|..||   |: :.:|.:::.|..
  Fly   338 PPTY----SSPGGLRGYPS-----ENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKP 393

  Fly    97 FTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSN--- 158
            ::..|.:|||.||..|.|:.:.:|.|:|:.|.|.||||||||||||||.||:.|.....::|   
  Fly   394 YSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNN 458

  Fly   159 --AKLAQPQAEQSAHRG 173
              :.....||.|..|.|
  Fly   459 SSSNHNHAQATQQHHSG 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 28/52 (54%)
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439756
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.