DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Dr

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster


Alignment Length:75 Identity:33/75 - (44%)
Similarity:43/75 - (57%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DENLPSQPNHDSQRVKLKRS-RTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIW 137
            |.|.|.:...:.::.|..|. ||.||:.||:.||.:|:...||....|.|.:..|.|.|.|||||
  Fly   404 DANEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIW 468

  Fly   138 FQNRRMKFKK 147
            |||||.|.|:
  Fly   469 FQNRRAKAKR 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 28/56 (50%)
DrNP_477324.1 Homeodomain 422..478 CDD:459649 28/55 (51%)

Return to query results.
Submit another query.