DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and ftz

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:330 Identity:89/330 - (26%)
Similarity:111/330 - (33%) Gaps:114/330 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYPVHQA---KVGSYSADPSEVKYSDLIYGHHHDVNPIGLPP--NYNQMNSNPTTLNDHCSPQHV 66
            |.|..|.   |.|.::..|              ...|..|||  ..:....:|...:.....|.:
  Fly   174 YSPQSQTQKLKNGDFATPP--------------PTTPTSLPPLEGISTPPQSPGEKSSSAVSQEI 224

  Fly    67 HQQHVSS------------DENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTR 119
            :.:.|::            :|.|.|... ||     ||:|..:|..|.:|||.||..|.|:.|.|
  Fly   225 NHRIVTAPNGAGDFNWSHIEETLASDCK-DS-----KRTRQTYTRYQTLELEKEFHFNRYITRRR 283

  Fly   120 RIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQD 184
            ||:||..|||.|||:||||||||||.|||......|:              |.|.....|   ..
  Fly   284 RIDIANALSLSERQIKIWFQNRRMKSKKDRTLDSSPE--------------HCGAGYTAM---LP 331

  Fly   185 PREGTAAAEKRPMMAVAPVNPKPDYQASQKMKTEASTNNGMCSSADLSEILEHLAQTTAAPQVST 249
            |.|.|:.|     ...||..|.|.|                           |..|||||     
  Fly   332 PLEATSTA-----TTGAPSVPVPMY---------------------------HHHQTTAA----- 359

  Fly   250 ATSSTGTSTNSASSSSSGH-YSYNVDLVLQSIKQDLEAAAQAWSKSKSAPILATQSWHPSSQSQV 313
                     ..|.|.|..| |....|...|...|..:|..|             |..|..|..|.
  Fly   360 ---------YPAYSHSHSHGYGLLNDYPQQQTHQQYDAYPQ-------------QYQHQCSYQQH 402

  Fly   314 PTSVH 318
            |..::
  Fly   403 PQDLY 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 32/52 (62%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 14/87 (16%)
Homeobox 257..310 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439780
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.