DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Scr

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:172 Identity:58/172 - (33%)
Similarity:77/172 - (44%) Gaps:31/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NPIGLPPNYNQMNSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLV 103
            |..|...|......||..:.......|:....|:::.             :.||.||::|..|.:
  Fly   286 NEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANG-------------ETKRQRTSYTRYQTL 337

  Fly   104 ELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKD--------IQGHREPKSN-- 158
            |||.||..|.||.|.||||||..|.|.|||:||||||||||:||:        :..|..|..:  
  Fly   338 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPYHMGPYGHPY 402

  Fly   159 -------AKLAQPQAEQSAH-RGIVKRLMSYSQDPREGTAAA 192
                   ::.|...|..:.| .|...||....|:|.:..|||
  Fly   403 HQFDIHPSQFAHLSAXDAWHFSGTGXRLNQLYQEPYQTAAAA 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 34/52 (65%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439784
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.