DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Dfd

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster


Alignment Length:334 Identity:88/334 - (26%)
Similarity:137/334 - (41%) Gaps:100/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQMNSNPTTLNDHCSPQHVHQQ---------- 69
            :||.:.|.||           .|...:...|:....|.|...|.|..|.:.:..:          
  Fly   292 MGSENDDMSE-----------EDRLMLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYP 345

  Fly    70 -----HVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSL 129
                 ||:...|...||.     ::.||.|||:|..|::|||.||..|.||.|.||||||..|.|
  Fly   346 WMKKIHVAGVANGSYQPG-----MEPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVL 405

  Fly   130 CERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEK 194
            .|||:||||||||||:|||   ::.|.:              :.:.|:.:..:.:|   |..|:|
  Fly   406 SERQIKIWFQNRRMKWKKD---NKLPNT--------------KNVRKKTVDANGNP---TPVAKK 450

  Fly   195 RPMMAVAPVNPKPDYQASQKMKT------------EASTNNGMCSSADLSEILEHLAQTTAAPQV 247
            ....|.:    |...||.|:.::            |...::.:.|..|:|..|.:.....|||:.
  Fly   451 PTKRAAS----KKQQQAQQQQQSQQQQTQQTPVMNECIRSDSLESIGDVSSSLGNPPYIPAAPET 511

  Fly   248 STA------------TSSTGTSTNSASSSSS-----------GHYSYNVDLVLQS---------- 279
            :::            .:.:|.:.|:.::::|           ||.:.:..|..|.          
  Fly   512 TSSYPGSQQHLSNNNNNGSGNNNNNNNNNNSNLNNNNNNNQMGHTNLHGHLQQQQSDLMTNLQLH 576

  Fly   280 IKQDLEAAA 288
            ||||.:..|
  Fly   577 IKQDYDLTA 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 35/52 (67%)
DfdNP_477201.1 Homeobox 370..422 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439735
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.