DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and bcd

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:256 Identity:63/256 - (24%)
Similarity:88/256 - (34%) Gaps:85/256 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HHDVNPIGLPP-----------------NYNQMNSNPTTLNDHCSPQHVHQQHVSSDENLPSQPN 82
            ||....:.|||                 |||.:..        ..|..:.:..|...|.||    
  Fly    37 HHQHPQLQLPPQFRNPFDLLFDERTGAINYNYIRP--------YLPNQMPKPDVFPSEELP---- 89

  Fly    83 HDSQRVKL-KRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFK 146
             ||..::. :|:||.|||.|:.|||..|....||...|..:::.:|:|...||||||:|||.:.|
  Fly    90 -DSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHK 153

  Fly   147 KDIQGHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAVAPVNPKPDYQA 211
            .....|::.........|..:||            ..||                     |..|.
  Fly   154 IQSDQHKDQSYEGMPLSPGMKQS------------DGDP---------------------PSLQT 185

  Fly   212 SQKMKTEASTNNGMCSSADLSEILEHLAQTTAAPQVSTATSSTGTSTNSASSSSSGHYSYN 272
                   .|...|...:|           .|.:|..||.|:.   .|...|.|.:.:|:||
  Fly   186 -------LSLGGGATPNA-----------LTPSPTPSTPTAH---MTEHYSESFNAYYNYN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 24/52 (46%)
bcdNP_788587.1 Homeobox 106..153 CDD:278475 20/46 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439768
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45664
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.