DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and zen2

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:238 Identity:81/238 - (34%)
Similarity:111/238 - (46%) Gaps:57/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQ 139
            |..|:.....|:  |.|||||||:|:||:|||.||..|.||.|||||||:|||:|.|||||||||
  Fly    30 EAAPTATTRSSE--KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQ 92

  Fly   140 NRRMKFKKDIQGHREPKSNAK-------LAQPQAEQSAH-----RGIVKRLMSYSQDP------- 185
            |||||.||        .:|.|       .:.|.:.||:.     ..||:||:.|:...       
  Fly    93 NRRMKLKK--------STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLR 149

  Fly   186 -------REGTAAA---------EKRPMMAVAPVNPKPDYQASQKMKTEASTNNGMCSSADLSE- 233
                   .||....         |..|.....|..|..::.|:.     ||:..|:..:..::| 
  Fly   150 QVDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANW-----ASSWLGLEPTIPIAEN 209

  Fly   234 ILEHLAQTTAAPQVSTATSSTGTSTNSASSSSSGHYSYNVDLV 276
            ::||  .|...|.:....    ..:||:|:|||.....:.|.:
  Fly   210 VIEH--NTQDQPMIQNFC----WDSNSSSASSSDILDVDYDFI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 41/52 (79%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 41/52 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460738
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45664
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.