DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and lab

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster


Alignment Length:425 Identity:91/425 - (21%)
Similarity:121/425 - (28%) Gaps:221/425 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVMHYYPVHQAKVGSYSADPSEV------KYSDLIYGHHHDV--NPIGLPPNYNQMNSNPTTLND 59
            |.|.::..|.|  |||:.|..:.      .:..|.:||..::  ||....|...|....|     
  Fly   262 SQMWHHQQHLA--GSYALDAMDSLGMHAHMHHGLPHGHLGNLANNPHQQQPQVQQQQQQP----- 319

  Fly    60 HCSPQH-------VHQQH----VSSDENLPSQ-------------------------------PN 82
            |..|||       .||||    ||.:..:..|                               ||
  Fly   320 HQQPQHPQNQSPAAHQQHHQNSVSPNGGMNRQQRGGVISPGSSTSSSTSASNGAHPASTQSKSPN 384

  Fly    83 HDS-----QRVKLKRS------------------------------------------------- 93
            |.|     :.::|||:                                                 
  Fly   385 HSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMHDYQMNGQLDMCRGGGGGGSGVGNGPVGVGGN 449

  Fly    94 -------------------------------------------------------RTAFTSVQLV 103
                                                                   ||.||:.||.
  Fly   450 GSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSGRTNFTNKQLT 514

  Fly   104 ELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQ 168
            |||.||..|.||.|.||||||..|.|.|.||||||||||||.||.:                   
  Fly   515 ELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRV------------------- 560

  Fly   169 SAHRGIVKRLMSYSQDPREGTAAAEKRPMMAVAPVNPKPDYQASQ-----KMKTEASTNNGMCSS 228
                             :||...|:.....:.:.::.||..|...     ::|::.|...|    
  Fly   561 -----------------KEGLIPADILTQHSTSVISEKPPQQQQPQPPELQLKSQGSDLGG---- 604

  Fly   229 ADLSEILEHLAQTTAAPQVSTATSSTGTSTNSASS 263
               :|:      .|.||...| |:.|.|:..|..|
  Fly   605 ---NEL------ATGAPSTPT-TAMTLTAPTSKQS 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 36/156 (23%)
labNP_476613.1 Homeobox 505..557 CDD:278475 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439792
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.