DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Hoxc9

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001094377.1 Gene:Hoxc9 / 368178 RGDID:1595784 Length:260 Species:Rattus norvegicus


Alignment Length:140 Identity:54/140 - (38%)
Similarity:68/140 - (48%) Gaps:28/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GHHHDVNPIGLP--------------PNYNQMNSNPTTLNDHC-----SPQH---VHQQHVSSDE 75
            |.|:.:.|...|              |:|  |..:|..|.|..     ||:.   ...:|.....
  Rat   113 GRHYALKPDAYPGRRADCGPGDGRSYPDY--MYGSPGELRDRAPQTLPSPEADALAGSKHKEEKA 175

  Fly    76 NL-PSQP--NHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIW 137
            :| ||.|  |....| ..::.|..:|..|.:|||.||..||||.|.||.|:|:.|:|.|||||||
  Rat   176 DLDPSNPVANWIHAR-STRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIW 239

  Fly   138 FQNRRMKFKK 147
            |||||||.||
  Rat   240 FQNRRMKMKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 33/55 (60%)
Hoxc9NP_001094377.1 Hox9_act 1..179 CDD:461369 14/67 (21%)
Homeodomain 193..241 CDD:459649 26/47 (55%)

Return to query results.
Submit another query.