DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and HOXD12

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_067016.3 Gene:HOXD12 / 3238 HGNCID:5135 Length:270 Species:Homo sapiens


Alignment Length:110 Identity:40/110 - (36%)
Similarity:58/110 - (52%) Gaps:9/110 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GLP--PNYNQMNSNPTTLNDHCSPQHVHQQHVSS--DENLPSQPNHDSQRVKLKRSRTAFTSVQL 102
            |.|  |.:......|..||     ..|....|:|  ..:||......:...:.::.|..:|..|:
Human   155 GAPCAPGFKDDTKGPLNLN-----MTVQAAGVASCLRPSLPDGLPWGAAPGRARKKRKPYTKQQI 214

  Fly   103 VELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKK 147
            .||||||..|.::.|.:|.|::.||:|.::||||||||||||.|:
Human   215 AELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 28/55 (51%)
HOXD12NP_067016.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..122
Homeodomain 203..259 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.