DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and HOXD9

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_055028.3 Gene:HOXD9 / 3235 HGNCID:5140 Length:352 Species:Homo sapiens


Alignment Length:105 Identity:46/105 - (43%)
Similarity:61/105 - (58%) Gaps:9/105 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NSNPTTLNDH----CSPQHVHQQHVSSDENLPSQPNHDS----QRVKLKRSRTAFTSVQLVELEN 107
            :|.|:..:||    ||.:...:|| |..:.....||:.:    .....::.|..:|..|.:|||.
Human   239 SSEPSACSDHPIPGCSLKEEEKQH-SQPQQQQLDPNNPAANWIHARSTRKKRCPYTKYQTLELEK 302

  Fly   108 EFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKK 147
            ||..||||.|.||.|:|:.|:|.||||||||||||||.||
Human   303 EFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 33/55 (60%)
HOXD9NP_055028.3 Hox9_act 11..>164 CDD:461369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..208
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..276 11/37 (30%)
Homeodomain 286..337 CDD:459649 29/50 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.