DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and HOXD4

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens


Alignment Length:117 Identity:51/117 - (43%)
Similarity:68/117 - (58%) Gaps:12/117 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQV 134
            ||:|     ..||:...  :.||||||:|..|::|||.||..|.||.|.||||||..|.|.|||:
Human   141 HVNS-----VNPNYTGG--EPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQI 198

  Fly   135 KIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAHRGIV--KRLMSYSQD 184
            ||||||||||:|||   |:.|.:..:.:...:..|....:.  :.|...::|
Human   199 KIWFQNRRMKWKKD---HKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 36/52 (69%)
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127
Antp-type hexapeptide 133..138
Homeobox 157..210 CDD:306543 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 6/39 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.