DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and HOXC12

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_776272.1 Gene:HOXC12 / 3228 HGNCID:5124 Length:282 Species:Homo sapiens


Alignment Length:75 Identity:34/75 - (45%)
Similarity:46/75 - (61%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIW 137
            |....|..|.:...|.|    |..::.:||.|||.||..|.::.|.||.|::.||:|.::|||||
Human   201 SASGAPWYPINSRSRKK----RKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIW 261

  Fly   138 FQNRRMKFKK 147
            |||||||.|:
Human   262 FQNRRMKKKR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 28/55 (51%)
HOXC12NP_776272.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..129
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..214 3/12 (25%)
Homeodomain 215..271 CDD:459649 30/59 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.