DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and HOXC8

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_073149.1 Gene:HOXC8 / 3224 HGNCID:5129 Length:242 Species:Homo sapiens


Alignment Length:174 Identity:54/174 - (31%)
Similarity:81/174 - (46%) Gaps:32/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQMNSNPTT----LNDHCSPQHVHQQHVSS 73
            :|...|.|.|.:     .:||...:.:.:..|...:..|:|.:.    ||.:.||..:       
Human    86 SKFYGYEALPRQ-----SLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLM------- 138

  Fly    74 DENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWF 138
               .|....|...|   :..|..::..|.:|||.||..|.||.|.||||::..|.|.||||||||
Human   139 ---FPWMRPHAPGR---RSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWF 197

  Fly   139 QNRRMKFKKD-----IQGHR-----EPKSNAKLAQPQAEQSAHR 172
            ||||||:||:     :.|.|     |.:.|.:..:.:.|:..::
Human   198 QNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 31/52 (60%)
HOXC8NP_073149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..154 9/52 (17%)
Antp-type hexapeptide 138..143 1/14 (7%)
Homeobox 153..205 CDD:306543 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..242 6/36 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.