DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment zen and HOXA3

DIOPT Version :9

Sequence 1:	NP_476793.1	Gene:	zen / 40828	FlyBaseID:	FBgn0004053	Length:	353	Species:	Drosophila melanogaster
Sequence 2:	NP_001371264.1	Gene:	HOXA3 / 3200	HGNCID:	5104	Length:	443	Species:	Homo sapiens

Alignment Length:	139	Identity:	59/139 - (42%)
Similarity:	72/139 - (51%)	Gaps:	35/139 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    40 PIGLPPNYNQMNSNPTTLNDHCSP-------------------QHVHQQHVSS--------DENL 77
            |....|..|..| |||..|...||                   |:..|:..||        |::.
Human   122 PSSASPPQNASN-NPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSSSSSGESCAGDKSP 185

  Fly    78 PSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRR 142
            |.|.:.       ||:|||:||.||||||.||..|.||.|.||:|:|..|:|.|||:||||||||
Human   186 PGQASS-------KRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRR 243

  Fly   143 MKFKKDIQG 151
            ||:|||.:|
Human   244 MKYKKDQKG 252

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
zen	NP_476793.1	Homeobox	93..146	CDD:278475	36/52 (69%)
HOXA3	NP_001371264.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	75..147		10/25 (40%)
		Antp-type hexapeptide	155..160		0/4 (0%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	159..196		9/43 (21%)
		Homeobox	195..248	CDD:395001	36/52 (69%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	247..338		4/6 (67%)
		DUF4074	378..441	CDD:404218
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	400..443
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
User_Submission	0	0.000	Not matched by this tool.
	3	2.770