DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and HOXA2

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_006726.1 Gene:HOXA2 / 3199 HGNCID:5103 Length:376 Species:Homo sapiens


Alignment Length:181 Identity:62/181 - (34%)
Similarity:84/181 - (46%) Gaps:20/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREP 155
            :|.|||:|:.||:|||.||..|.||.|.||:|||..|.|.|||||:||||||||.|:..|.....
Human   144 RRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQ 208

  Fly   156 KSNAKL-----AQPQAEQSAHRGIVKRLMSYSQD--PREGTAAAEKRPMMAVAPVNPKPDYQASQ 213
            .|..|.     ::...|....:.:.::.:|.|..  .|||....:.......||.....|   ||
Human   209 NSEGKCKSLEDSEKVEEDEEEKTLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGD---SQ 270

  Fly   214 KMKTEASTNNGMCSSADLSEILEHLA-QTTAAPQ-VSTATSSTGTSTNSAS 262
            .......|:|        .:.|:|.. |:...|. :||...:.|...|:.|
Human   271 SFPVSPLTSN--------EKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 35/52 (67%)
HOXA2NP_006726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..93
Antp-type hexapeptide 94..99
Homeobox 147..200 CDD:395001 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..229 5/30 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..279 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.