DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Hoxc13

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_235695.3 Gene:Hoxc13 / 315337 RGDID:1563984 Length:328 Species:Rattus norvegicus


Alignment Length:162 Identity:51/162 - (31%)
Similarity:77/162 - (47%) Gaps:23/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYPVHQAKVGSYSADPSEVKYSDL-----IYGH----HHDVNPIGLPPNYNQMN-SNPTTLNDHC 61
            :||   :...||.|.|.   |.|:     |.||    |..:.|:   ..|.... ||......:|
  Rat   172 FYP---SFASSYQAMPG---YLDVSVVPGISGHPEPRHDALIPV---EGYQHWALSNGWDSQVYC 227

  Fly    62 SPQHVHQQHVSSD---ENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEI 123
            |.:.....|:...   :.:|.||...|.| :.::.|..:|.|||.|||.|:.::.::.:.:|..|
  Rat   228 SKEQSQSAHLWKSPFPDVVPLQPEVSSYR-RGRKKRVPYTKVQLKELEKEYAASKFITKEKRRRI 291

  Fly   124 AQRLSLCERQVKIWFQNRRMKFKKDIQGHREP 155
            :...:|.||||.|||||||:|.||.:...:.|
  Rat   292 SATTNLSERQVTIWFQNRRVKEKKVVSKSKAP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 24/55 (44%)
Hoxc13XP_235695.3 HoxA13_N 52..166 CDD:463521
Homeodomain 259..310 CDD:459649 21/50 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.