DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Vsx1

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster


Alignment Length:329 Identity:71/329 - (21%)
Similarity:111/329 - (33%) Gaps:111/329 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ--G 151
            |.:..||.|||.||.|||..||...|...:.|..::.:..|.|.::::|:||||.|::|..:  |
  Fly   394 KRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTEKCWG 458

  Fly   152 HREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAVAP---VNPKPDYQASQ 213
            |         :...||...:..:|:..:     |...|.....:...:|||   ...|...:|::
  Fly   459 H---------STKMAEYGLYGAMVRHSL-----PLPETIIKSAKEDESVAPWLLGMHKKSLEAAE 509

  Fly   214 KMKTE------------------ASTNNGMCSSADLSEIL------------------------- 235
            .:|::                  .||:|...||..:|.:|                         
  Fly   510 LLKSDESDRETPTSDDTNTSYSAGSTHNSPISSFSISRLLFDAPPPAAGSAGGKGHHHHHHHHKG 574

  Fly   236 EHLAQTTAAPQ-------------------------VSTATSS------TGTSTNSASSSSSG-- 267
            .|.|...|..|                         :..|.:|      .||.:.|.|.|.||  
  Fly   575 HHHAHVHAQAQAHAHMLLHHQQQQQQQQQQQQHHHHLHAAENSLQQQQVAGTGSGSGSGSGSGTG 639

  Fly   268 --------HYSYNVDLVLQSIKQDLEAAAQAWSKSKSAPILATQSWHPSSQSQVPTSVHAAPSMN 324
                    |:.||....|..::|..:...|...:::.      |..|...|..  .|||.....|
  Fly   640 AGSTGPPAHHPYNQQQHLHHLQQLQQQQQQQQQQAQQ------QQQHHHHQHH--HSVHHMHHHN 696

  Fly   325 LSWG 328
            .:.|
  Fly   697 AAAG 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 22/52 (42%)
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I2435
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.