Sequence 1: | NP_476793.1 | Gene: | zen / 40828 | FlyBaseID: | FBgn0004053 | Length: | 353 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571518.2 | Gene: | pdx1 / 30721 | ZFINID: | ZDB-GENE-990415-122 | Length: | 246 | Species: | Danio rerio |
Alignment Length: | 254 | Identity: | 76/254 - (29%) |
---|---|---|---|
Similarity: | 106/254 - (41%) | Gaps: | 66/254 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSSVMHYYPVHQAKVGS----------YSADPSEVKYSDLIYGHHHDVNPIGL--PPNYNQMNSN 53
Fly 54 PTTLNDHCSPQHVHQQHVS-----------------SDEN---LP-----SQPNHDS-------- 85
Fly 86 ----QRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFK 146
Fly 147 KDIQGHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAVAPVNP 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
zen | NP_476793.1 | Homeobox | 93..146 | CDD:278475 | 33/52 (63%) |
pdx1 | NP_571518.2 | Homeobox | 140..193 | CDD:278475 | 33/52 (63%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |