Sequence 1: | NP_476793.1 | Gene: | zen / 40828 | FlyBaseID: | FBgn0004053 | Length: | 353 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001295569.1 | Gene: | nkx2.2a / 30697 | ZFINID: | ZDB-GENE-980526-403 | Length: | 273 | Species: | Danio rerio |
Alignment Length: | 218 | Identity: | 58/218 - (26%) |
---|---|---|---|
Similarity: | 83/218 - (38%) | Gaps: | 69/218 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 NSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHD-------SQRVKLKRSRTAFTSVQLVELENE 108
Fly 109 FKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAHRG 173
Fly 174 I-VKRLMSYSQDPREGTAAAEKRPMMAVAPVNPKPDYQASQKMKTE---ASTNNGMCSSADLSEI 234
Fly 235 LEHL-------AQTTAAPQVSTA 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
zen | NP_476793.1 | Homeobox | 93..146 | CDD:278475 | 22/52 (42%) |
nkx2.2a | NP_001295569.1 | COG5576 | 93..218 | CDD:227863 | 44/170 (26%) |
Homeobox | 132..185 | CDD:278475 | 22/52 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |