DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and nkx2.2a

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001295569.1 Gene:nkx2.2a / 30697 ZFINID:ZDB-GENE-980526-403 Length:273 Species:Danio rerio


Alignment Length:218 Identity:58/218 - (26%)
Similarity:83/218 - (38%) Gaps:69/218 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHD-------SQRVKLKRSRTAFTSVQLVELENE 108
            ||..|:..   ||:      .|:||:    |::|       |...|.::.|..|:..|..|||..
Zfish    96 NSQDTSAK---SPE------PSADES----PDNDKETSSNGSDSGKKRKRRVLFSKAQTYELERR 147

  Fly   109 FKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAHRG 173
            |:...||....|..:|..:.|...||||||||.|.|.|:                    ..|.:|
Zfish   148 FRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKR--------------------ARAEKG 192

  Fly   174 I-VKRLMSYSQDPREGTAAAEKRPMMAVAPVNPKPDYQASQKMKTE---ASTNNGMCSSADLSEI 234
            : |..|.|               |.....||..: |.:....:|.:   |:...|:..||..::.
Zfish   193 MEVTHLPS---------------PRRVAVPVLVR-DGKPCHTLKAQDLAATFQAGIPFSAYSAQS 241

  Fly   235 LEHL-------AQTTAAPQVSTA 250
            |:|:       |.||  ||..||
Zfish   242 LQHMQYNAHYSAATT--PQFPTA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 22/52 (42%)
nkx2.2aNP_001295569.1 COG5576 93..218 CDD:227863 44/170 (26%)
Homeobox 132..185 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.