DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and hoxc5a

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_571219.2 Gene:hoxc5a / 30379 ZFINID:ZDB-GENE-980526-533 Length:233 Species:Danio rerio


Alignment Length:91 Identity:48/91 - (52%)
Similarity:55/91 - (60%) Gaps:8/91 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VHQQHVSSDENLPSQPN--------HDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIE 122
            :.||..|:.....|||.        |.|.....|||||::|..|.:|||.||..|.||.|.||||
Zfish   134 IKQQTNSTQRQNQSQPQIYPWMTKLHMSHESDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIE 198

  Fly   123 IAQRLSLCERQVKIWFQNRRMKFKKD 148
            ||..|.|.|||:||||||||||:|||
Zfish   199 IANNLCLNERQIKIWFQNRRMKWKKD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 35/52 (67%)
hoxc5aNP_571219.2 Homeobox 169..222 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.