DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and hoxc4a

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_571197.1 Gene:hoxc4a / 30345 ZFINID:ZDB-GENE-990415-112 Length:268 Species:Danio rerio


Alignment Length:284 Identity:83/284 - (29%)
Similarity:104/284 - (36%) Gaps:105/284 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PVHQAKVGSYSADPSEVKYS---DLIYGHHHDVNPIGLPP--NYNQMNSN------PTTLNDHCS 62
            |..:....||..:.|...||   |..|.|||...   .||  :|.:...|      |.|...|..
Zfish    19 PCEEYSQNSYIPEHSPEYYSRARDSGYQHHHQEL---YPPRASYQERQYNCASIPEPDTQRGHGL 80

  Fly    63 PQHVHQQHV--------------------------SSDENLPSQPNHDSQR-------------- 87
            |   |..|:                          :.::..|..||..:..              
Zfish    81 P---HAGHLLGKGQSASCEPPPLPLSPATPSAASSACNQATPEHPNSSASAKQPVVYPWMKKIHV 142

  Fly    88 ---------VKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRM 143
                     .:.||||||:|..|::|||.||..|.||.|.||||||..|.|.|||:|||||||||
Zfish   143 STVNSSYNGAEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLVLSERQIKIWFQNRRM 207

  Fly   144 KFKKDIQGHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAVAPVNPKPD 208
            |:|||   ||.|.:..:       .|:..||       |......:||.                
Zfish   208 KWKKD---HRLPNTKVR-------SSSSTGI-------SSGSNTSSAAG---------------- 239

  Fly   209 YQASQKMKTEASTNNGMCSSADLS 232
                  :...|||.|.|.:|.|||
Zfish   240 ------VVAAASTTNTMSASEDLS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 36/52 (69%)
hoxc4aNP_571197.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..129 9/61 (15%)
Antp-type hexapeptide 133..138 0/4 (0%)
Homeobox 157..210 CDD:278475 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..268 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.