DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and hoxb5a

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_571176.2 Gene:hoxb5a / 30317 ZFINID:ZDB-GENE-980526-70 Length:275 Species:Danio rerio


Alignment Length:153 Identity:56/153 - (36%)
Similarity:75/153 - (49%) Gaps:26/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVMHYYPVHQAKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQMNSNPTT--LNDHCSP 63
            ::|..|:..:.:|...|.:.:.|           |...|.........:..:..||  .:|..:|
Zfish   127 LNSNTHFTEIDEASASSETEEAS-----------HRANNSAPRTQQKQETTATSTTSATSDGQAP 180

  Fly    64 Q---HVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQ 125
            |   .:.:.|:|.|...|..          ||:|||:|..|.:|||.||..|.||.|.||||||.
Zfish   181 QIFPWMRKLHISHDMTGPDG----------KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAH 235

  Fly   126 RLSLCERQVKIWFQNRRMKFKKD 148
            .|.|.|||:||||||||||:|||
Zfish   236 ALCLSERQIKIWFQNRRMKWKKD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 35/52 (67%)
hoxb5aNP_571176.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..181 10/64 (16%)
Antp-type hexapeptide 182..187 0/4 (0%)
Homeobox 204..256 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.