DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and en2b

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_571115.1 Gene:en2b / 30238 ZFINID:ZDB-GENE-980526-40 Length:261 Species:Danio rerio


Alignment Length:57 Identity:34/57 - (59%)
Similarity:41/57 - (71%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKK 147
            ||.|||||:.||..|:|||::|.||...||..:||.|.|.|.|:||||||:|.|.||
Zfish   173 KRPRTAFTAEQLQRLKNEFQNNRYLTEQRRQALAQELGLNESQIKIWFQNKRAKIKK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 32/55 (58%)
en2bNP_571115.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..125
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..176 2/2 (100%)
Homeodomain 173..229 CDD:459649 32/55 (58%)
Engrail_1_C_sig 230..260 CDD:431338 34/57 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.