DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Hoxd13

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001099356.1 Gene:Hoxd13 / 288154 RGDID:1308417 Length:331 Species:Rattus norvegicus


Alignment Length:100 Identity:37/100 - (37%)
Similarity:53/100 - (53%) Gaps:2/100 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NQMNSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSN 112
            |..||......|.....|..:.....|..| :||:....| :.::.|..:|.:||.|||||:..|
  Rat   224 NGWNSQVYCAKDQPQGSHFWKSSFPGDVAL-NQPDMCVYR-RGRKKRVPYTKLQLKELENEYAIN 286

  Fly   113 MYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKK 147
            .::.:.:|..|:...:|.||||.|||||||:|.||
  Rat   287 KFINKDKRRRISAATNLSERQVTIWFQNRRVKDKK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 25/55 (45%)
Hoxd13NP_001099356.1 HoxA13_N <113..160 CDD:463521
Homeodomain 265..321 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.