DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and ind

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:173 Identity:66/173 - (38%)
Similarity:81/173 - (46%) Gaps:28/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PVHQ------------AKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQMNSNPTTLNDHC 61
            |:|.            .:.||:...||....:.|.|.::.| .|.|  ..:...:|        |
  Fly   145 PIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDYTNNFD-EPQG--KRFKHESS--------C 198

  Fly    62 SPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQR 126
            ||.....::.||...:...|..:......||.||||||.||:|||.||..|.||.|.||||||.|
  Fly   199 SPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANR 263

  Fly   127 LSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKL---AQPQA 166
            |.|.|:||||||||||:|.||.  |...|..|...   ..|||
  Fly   264 LRLSEKQVKIWFQNRRVKQKKG--GSESPTFNLSTNSNGSPQA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 38/52 (73%)
indNP_996087.2 Homeobox 231..283 CDD:278475 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460740
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.