DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and GBX2

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001476.2 Gene:GBX2 / 2637 HGNCID:4186 Length:348 Species:Homo sapiens


Alignment Length:119 Identity:50/119 - (42%)
Similarity:59/119 - (49%) Gaps:26/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SSDENLPSQ-------PNHDSQRV--------------KLKRSRTAFTSVQLVELENEFKSNMYL 115
            |||:||..|       |.|..:..              |.:|.||||||.||:|||.||....||
Human   208 SSDDNLTGQAAHKEEDPGHALEETPPSSGAAGSTTSTGKNRRRRTAFTSEQLLELEKEFHCKKYL 272

  Fly   116 YRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHR-----EPKSNAKLAQP 164
            ..|.|.:||..|.|.|.||||||||||.|:|:...|:.     ||..|.|:..|
Human   273 SLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTGEPSRNPKIVVP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 33/52 (63%)
GBX2NP_001476.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 10/42 (24%)
Homeobox 250..303 CDD:306543 33/52 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.