DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Nkx6-1

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_659204.1 Gene:Nkx6-1 / 18096 MGIID:1206039 Length:365 Species:Mus musculus


Alignment Length:174 Identity:48/174 - (27%)
Similarity:78/174 - (44%) Gaps:34/174 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQ 125
            |:|   ||..:..|:        |.:|   |.:|..|:..|:..||..|:...||....|..:|.
Mouse   222 CTP---HQGSILLDK--------DGKR---KHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAY 272

  Fly   126 RLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDPREGTA 190
            .|.:.|.|||:||||||.|::|        |..|::|..:.:|.:.   .:||        :||:
Mouse   273 SLGMTESQVKVWFQNRRTKWRK--------KHAAEMATAKKKQDSE---TERL--------KGTS 318

  Fly   191 AAEKRPMMAVAPVNP-KPDYQASQKMKTEASTNNGMCSSADLSE 233
            ..|:.......|::| ..|.:.:|.:|...|:...:...|..:|
Mouse   319 ENEEDDDDYNKPLDPNSDDEKITQLLKKHKSSGGSLLLHASEAE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 23/55 (42%)
Nkx6-1NP_659204.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..136
Repressor domain. /evidence=ECO:0000250 102..269 17/60 (28%)
Homeodomain 236..294 CDD:459649 24/60 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..365 17/79 (22%)
Involved in DNA-binding. /evidence=ECO:0000250 307..365 14/67 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.