DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Hoxd9

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_038583.1 Gene:Hoxd9 / 15438 MGIID:96210 Length:339 Species:Mus musculus


Alignment Length:110 Identity:46/110 - (41%)
Similarity:60/110 - (54%) Gaps:19/110 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRV-------------KLKRSRTAFTSVQL 102
            :|.|:..:||.||    ...:..:|..|.||  ..|::             ..::.|..:|..|.
Mouse   226 SSEPSACSDHPSP----GCSLKEEEKQPPQP--PQQQLDPNNPAANWIHARSTRKKRCPYTKYQT 284

  Fly   103 VELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKK 147
            :|||.||..||||.|.||.|:|:.|:|.||||||||||||||.||
Mouse   285 LELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 33/55 (60%)
Hoxd9NP_038583.1 Hox9_act 1..>153 CDD:461369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..198
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..263 11/42 (26%)
Homeodomain 273..324 CDD:459649 29/50 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.