DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Hoxd13

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_032301.2 Gene:Hoxd13 / 15433 MGIID:96205 Length:339 Species:Mus musculus


Alignment Length:100 Identity:37/100 - (37%)
Similarity:53/100 - (53%) Gaps:2/100 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NQMNSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSN 112
            |..||......|.....|..:.....|..| :||:....| :.::.|..:|.:||.|||||:..|
Mouse   232 NGWNSQVYCAKDQPQGSHFWKSSFPGDVAL-NQPDMCVYR-RGRKKRVPYTKLQLKELENEYAIN 294

  Fly   113 MYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKK 147
            .::.:.:|..|:...:|.||||.|||||||:|.||
Mouse   295 KFINKDKRRRISAATNLSERQVTIWFQNRRVKDKK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 25/55 (45%)
Hoxd13NP_032301.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
HoxA13_N <121..168 CDD:463521
Homeodomain 273..329 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.