DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Hoxd1

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus


Alignment Length:196 Identity:60/196 - (30%)
Similarity:82/196 - (41%) Gaps:53/196 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VHQAKVGSYSADPSEVKYSDLIYGHHHDVNPI---------GLPPNYNQMNSNPTTLNDHCSPQH 65
            ||.|....:|...|.:....:.:....:..|.         |.|..:..::..|.......||  
Mouse   132 VHYATSAVFSGGGSFLLSGQVDFAAFGEPGPFPACLKEPADGHPGPFQTVSPAPGACPKPASP-- 194

  Fly    66 VHQQHVSSDENLPSQPNHDS-QRVKLKRS-------------------RTAFTSVQLVELENEFK 110
                    ..:||:.  |.: :.:|:||:                   ||.|::.||.|||.||.
Mouse   195 --------TSSLPAA--HSTFEWMKVKRNAPKKSKLSEYGATSPPSAIRTNFSTKQLTELEKEFH 249

  Fly   111 SNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPK-------SNAKLAQPQAEQ 168
            .|.||.|.||||||..|.|.:.||||||||||||.||     ||.:       |.|.:..|::|.
Mouse   250 FNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMKQKK-----REREGLLATAASVASIKLPRSET 309

  Fly   169 S 169
            |
Mouse   310 S 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 34/71 (48%)
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134
Antp-type hexapeptide 204..209 0/4 (0%)
Homeobox 233..285 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.