DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Hoxb13

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_032293.1 Gene:Hoxb13 / 15408 MGIID:107730 Length:286 Species:Mus musculus


Alignment Length:57 Identity:25/57 - (43%)
Similarity:39/57 - (68%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKK 147
            ::.|..::..||.|||.|:.:|.::.:.:|.:|:...||.|||:.|||||||:|.||
Mouse   219 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 23/55 (42%)
Hoxb13NP_032293.1 HoxA13_N 12..124 CDD:463521
Homeodomain 219..275 CDD:459649 23/55 (42%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:Q92826 219..248 8/28 (29%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:Q92826 260..275 10/14 (71%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:Q92826 272..275 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.