DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Hoxa4

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_032291.1 Gene:Hoxa4 / 15401 MGIID:96176 Length:285 Species:Mus musculus


Alignment Length:120 Identity:56/120 - (46%)
Similarity:68/120 - (56%) Gaps:16/120 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLC 130
            :|...|:|..| ..:|         ||||||:|..|::|||.||..|.||.|.||||||..|.|.
Mouse   166 IHVSAVNSSYN-GGEP---------KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLS 220

  Fly   131 ERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAHRGIVKRLMSYSQDP 185
            ||||||||||||||:|||   |:.|  |.|:..... .||..|...:..::|..|
Mouse   221 ERQVKIWFQNRRMKWKKD---HKLP--NTKMRSSNT-ASAPAGPPGKAQTHSPHP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 39/55 (71%)
Hoxa4NP_032291.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..70
PHA03247 <43..161 CDD:223021
Antp-type hexapeptide 159..164
Homeodomain 181..237 CDD:459649 39/55 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..285 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.