DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Hoxa1

DIOPT Version :9

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_034579.3 Gene:Hoxa1 / 15394 MGIID:96170 Length:336 Species:Mus musculus


Alignment Length:276 Identity:75/276 - (27%)
Similarity:101/276 - (36%) Gaps:100/276 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VMHYYPVHQAKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQMNSNPTTLNDHCSPQHV-H 67
            |.|::. ||...|.....|..:.:|   ||.             .|......|.|:..||.|. |
Mouse   141 VQHHHH-HQGYAGGTVGSPQYIHHS---YGQ-------------EQQTLALATYNNSLSPLHASH 188

  Fly    68 QQHVSSDENLPSQPNHDSQRVKLKRS-------------------RTAFTSVQLVELENEFKSNM 113
            |:...|..:..|.|......:|:||:                   ||.||:.||.|||.||..|.
Mouse   189 QEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYVGQPNAVRTNFTTKQLTELEKEFHFNK 253

  Fly   114 YLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKSNAKLAQPQAEQSAHRGIVKRL 178
            ||.|.||:|||..|.|.|.||||||||||||.||                               
Mouse   254 YLTRARRVEIAASLQLNETQVKIWFQNRRMKQKK------------------------------- 287

  Fly   179 MSYSQDPREGTAAAEKRPMMAVAPVNPKPDYQASQKMKTEASTNNGMCSSADLSEILEHLAQTTA 243
                         .||..::.::|..|     .....|||.|:              |..:.:.:
Mouse   288 -------------REKEGLLPISPATP-----PGSDEKTEESS--------------EKSSPSPS 320

  Fly   244 APQVSTATSSTGTSTN 259
            ||..:::||.|.|:::
Mouse   321 APSPASSTSDTLTTSH 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 35/71 (49%)
Hoxa1NP_034579.3 COG5576 177..>287 CDD:227863 47/109 (43%)
Homeobox 234..287 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.