DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and hoxc10

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001258236.1 Gene:hoxc10 / 100487723 XenbaseID:XB-GENE-486915 Length:351 Species:Xenopus tropicalis


Alignment Length:115 Identity:41/115 - (35%)
Similarity:60/115 - (52%) Gaps:24/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LPPNYNQMNSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKL----------KRSRTAF 97
            |||  ::.:..|:...|            :|.:|..::...|.:....          ::.|..:
 Frog   234 LPP--SEGDKEPSKNTD------------TSTDNSDAEAKEDIKAENAAGNWLTAKSGRKKRCPY 284

  Fly    98 TSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKK 147
            |..|.:|||.||..||||.|.||:||::.::|.:|||||||||||||.||
 Frog   285 TKHQTLELEKEFLFNMYLTRERRLEISKSINLTDRQVKIWFQNRRMKLKK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 31/55 (56%)
hoxc10NP_001258236.1 Homeodomain 278..334 CDD:459649 31/55 (56%)

Return to query results.
Submit another query.