DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and HB5

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_201334.1 Gene:HB5 / 836656 AraportID:AT5G65310 Length:312 Species:Arabidopsis thaliana


Alignment Length:221 Identity:59/221 - (26%)
Similarity:98/221 - (44%) Gaps:45/221 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLK 99
            |::.::||.:|    ....|:..||:.|.::..|...|:::::|.|.|..|||.|||||||.:.|
plant    65 ASSTAAEKKRR----LGVEQVKALEKNFEIDNKLEPERKVKLAQELGLQPRQVAIWFQNRRARWK 125

  Fly   100 -KSTNRKGAIGALTTSIPLSSQSSEDLQKD-DQIVERLLRY-ANTNV-------ETAPLRQVD-- 152
             |...|.  .|.|.::.....::.:.||:| |.::.::... |..||       |...|:.|:  
plant   126 TKQLERD--YGVLKSNFDALKRNRDSLQRDNDSLLGQIKELKAKLNVEGVKGIEENGALKAVEAN 188

  Fly   153 HGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGLEPTIPIAENVIEHNTQD 217
            ..|:...::..       |...||.|.  |.:|   .||          ||..:|..:.    ..
plant   189 QSVMANNEVLE-------LSHRSPSPP--PHIP---TDA----------PTSELAFEMF----SI 227

  Fly   218 QPMIQNFCWDSNSSSASSSDILDVDY 243
            .|..:|| .|..:.|:.||.:|:.:|
plant   228 FPRTENF-RDDPADSSDSSAVLNEEY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 19/52 (37%)
HB5NP_201334.1 Homeobox 79..125 CDD:278475 19/45 (42%)
HALZ 127..168 CDD:280364 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2625
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.