DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and HB16

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 / 830169 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana


Alignment Length:204 Identity:51/204 - (25%)
Similarity:85/204 - (41%) Gaps:30/204 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNR 104
            |||.:|.:..    |:..||:.|.|...|...|:.:::|.|.|..|||.:||||||.:.|.....
plant    57 SEKKRRLKVD----QVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLE 117

  Fly   105 KGAIGALTTSIPLSSQSSEDLQKDD----QIVERLLRYANTNVETAPLRQVDHGVLEEGQITPPY 165
            |. .|.|.........:.:.|::|:    |.:.::....|...:....:.:..||.||       
plant   118 KD-YGVLKGQYDSLRHNFDSLRRDNDSLLQEISKIKAKVNGEEDNNNNKAITEGVKEE------- 174

  Fly   166 QSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGLEPTIPIAENVIEHNTQDQPMIQNFCWDSNS 230
                .:|:....|.:..|...:....|:..|:..|...:| ...|:|..:.|.      | ||::
plant   175 ----EVHKTDSIPSSPLQFLEHSSGFNYRRSFTDLRDLLP-NSTVVEAGSSDS------C-DSSA 227

  Fly   231 --SSASSSD 237
              :..:|||
plant   228 VLNDETSSD 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 19/52 (37%)
HB16NP_195716.1 Homeobox 59..112 CDD:395001 21/56 (38%)
HALZ 114..155 CDD:396657 6/41 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2625
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.