DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and HAT3

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:61 Identity:20/61 - (32%)
Similarity:35/61 - (57%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLK 99
            :.:.|.|.:...|..|.:.||..|..:..|...:::.::::|.|..|||::||||||.:.|
plant   155 NGDDSSRKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 19/56 (34%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:461370
Homeodomain 161..215 CDD:459649 18/53 (34%)
HALZ 217..260 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.