DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and HB-1

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_186796.1 Gene:HB-1 / 821138 AraportID:AT3G01470 Length:272 Species:Arabidopsis thaliana


Alignment Length:278 Identity:60/278 - (21%)
Similarity:96/278 - (34%) Gaps:104/278 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IQSENYFVDNYSVSDLMMYPCVELN--VEAAPTATTRSSEKSKRSRTAFSSL-----------QL 55
            ::|.::|.|..:.....|:....||  |:.....:..:.|::.:.|..|||.           ||
plant     1 MESNSFFFDPSASHGNSMFFLGNLNPVVQGGGARSMMNMEETSKRRPFFSSPEDLYDDDFYDDQL 65

  Fly    56 IE------------LEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAI 108
            .|            ||:.|.....|...|:.:::::|.|..|||.:||||||.:.|         
plant    66 PEKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK--------- 121

  Fly   109 GALTTSIPLSSQSSEDLQKD--------DQIVERLLRYANTNVETAPLRQVDHGVLE------EG 159
                         ::.|::|        ||:   |..|.:..::...||.....:.|      |.
plant   122 -------------TKQLERDYDLLKSTYDQL---LSNYDSIVMDNDKLRSEVTSLTEKLQGKQET 170

  Fly   160 QITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGLEPTIPIAENVIEHNTQDQPMIQNF 224
            ...||.|        .|||        |:.|              |:..|.....|:|:      
plant   171 ANEPPGQ--------VPEP--------NQLD--------------PVYINAAAIKTEDR------ 199

  Fly   225 CWDSNSSSASSSDILDVD 242
                .||.:..|.:||.|
plant   200 ----LSSGSVGSAVLDDD 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 23/75 (31%)
HB-1NP_186796.1 HOX 66..121 CDD:197696 17/54 (31%)
HALZ 123..165 CDD:396657 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2625
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.