DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment zen2 and HB4

DIOPT Version :9

Sequence 1:	NP_476794.1	Gene:	zen2 / 40827	FlyBaseID:	FBgn0004054	Length:	252	Species:	Drosophila melanogaster
Sequence 2:	NP_182018.1	Gene:	HB4 / 819100	AraportID:	AT2G44910	Length:	318	Species:	Arabidopsis thaliana

Alignment Length:	55	Identity:	19/55 - (34%)
Similarity:	32/55 - (58%)	Gaps:	0/55 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    45 RSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLK 99
            |.:...|..|.:.||..|..:..|...:::.::::|.|..|||::||||||.:.|
plant   162 RKKLRLSKDQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTK 216

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
zen2	NP_476794.1	Homeobox	46..99	CDD:278475	17/52 (33%)
HB4	NP_182018.1	HD-ZIP_N	8..124	CDD:398351
		Homeobox	166..216	CDD:395001	17/49 (35%)
		HALZ	218..261	CDD:128634
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	1	1.000	53	1.000	Domainoid score	I4196
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X14
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.910