DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and vsx2

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_005158862.1 Gene:vsx2 / 796163 ZFINID:ZDB-GENE-001222-1 Length:393 Species:Danio rerio


Alignment Length:184 Identity:49/184 - (26%)
Similarity:72/184 - (39%) Gaps:43/184 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QSENYFVDNYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLA 69
            ||.:...|:.|.|:..|         :..:.:.....|.:|.||.|:|.||.|||:.|:...|..
Zfish   136 QSASSDSDDVSSSERKM---------SKSSLSQSKKRKKRRHRTIFTSYQLEELEKAFNEAHYPD 191

  Fly    70 RTRRIEISQRLALTERQVKIWFQNRRMKLKKSTN---------RKGAIGALTT-SIPLSSQSSED 124
            ...|..::.:..|.|.::::||||||.|.:|...         ..|..||:.. ||||.      
Zfish   192 VYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLP------ 250

  Fly   125 LQKDDQIVERLLRYANTNV--ETAPLRQVDHGVLEEGQITPPYQSYDYLHEFSP 176
                    |.:|:.|...:  ..||...|..|.        |..|....||:.|
Zfish   251 --------ESILKSAKDGIMDSCAPWLLVQDGF--------PTTSCFSKHEYPP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 21/52 (40%)
vsx2XP_005158862.1 Homeobox 170..221 CDD:278475 20/50 (40%)
OAR 338..355 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.