DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Barx2

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_003750505.1 Gene:Barx2 / 679701 RGDID:1584840 Length:290 Species:Rattus norvegicus


Alignment Length:162 Identity:57/162 - (35%)
Similarity:77/162 - (47%) Gaps:13/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNR 94
            |:.....|...:|.:||||.|:.|||:.||::|...|||:...|::::|.|.||:.|||.|:|||
  Rat   131 ESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNR 195

  Fly    95 RMKLKKSTNRKGAIGALT--------TSIPLSS--QSSEDLQKDDQIVERLLRYANTNVETAPLR 149
            |||.||.. .||...|.|        .|||.|.  ::.|.:....|..|:|...........|  
  Rat   196 RMKWKKMV-LKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQEQLGSLQGQEEPRDP-- 257

  Fly   150 QVDHGVLEEGQITPPYQSYDYLHEFSPEPMAL 181
            |.....|...::..|.|....|.|.|.||..|
  Rat   258 QEPKACLVPLEVAEPSQQPQELPEASSEPPPL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 28/52 (54%)
Barx2XP_003750505.1 Homeobox 147..200 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.