DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Vax2

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_072159.2 Gene:Vax2 / 64572 RGDID:621133 Length:292 Species:Rattus norvegicus


Alignment Length:168 Identity:51/168 - (30%)
Similarity:78/168 - (46%) Gaps:62/168 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNR- 104
            ::.||:||:|::.||..||.||...:|:....|.|::::|.|:|.|||:||||||.|.||..:| 
  Rat   100 DRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRD 164

  Fly   105 --KGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITPPYQS 167
              |.|          ||.:||             .:|.:||    ||     :||:|::      
  Rat   165 LEKRA----------SSSASE-------------AFATSNV----LR-----LLEQGRL------ 191

  Fly   168 YDYLHEFSPEPMALPQLPFNEFDANWASSWLGLEPTIP 205
                       :::|:.|          |.|.|.|.:|
  Rat   192 -----------LSVPRAP----------SLLALSPGLP 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 27/55 (49%)