DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and ceh-63

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001123094.1 Gene:ceh-63 / 6418830 WormBaseID:WBGene00045215 Length:152 Species:Caenorhabditis elegans


Alignment Length:106 Identity:41/106 - (38%)
Similarity:60/106 - (56%) Gaps:13/106 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQ 92
            |::..|..:.|.::     ||.|:|.|:..||.||..|:|:.:.||.|::|.:.|||.|||.|||
 Worm    31 NIKPPPKRSNRPTK-----RTTFTSEQVTLLELEFAKNEYICKDRRGELAQTIELTECQVKTWFQ 90

  Fly    93 NRRMK-------LKKSTNRKGAIGALTTSIPLSSQSSEDLQ 126
            |||.|       |:||..:|....:.:...| |||..::||
 Worm    91 NRRTKKRRCTSPLRKSMMKKSDERSPSPQNP-SSQHVQNLQ 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 28/59 (47%)
ceh-63NP_001123094.1 Homeobox 44..98 CDD:365835 28/58 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.