DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxb6b

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_571613.1 Gene:hoxb6b / 58053 ZFINID:ZDB-GENE-000823-7 Length:224 Species:Danio rerio


Alignment Length:100 Identity:47/100 - (47%)
Similarity:59/100 - (59%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SENYFVDNYSVSD---LMMYPCVEL--NVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLN 65
            :|.||    |..|   ..:||.::.  :....|.:|.|      |.|..::..|.:|||:|||.|
Zfish   115 TERYF----STEDKPCTPVYPWMQRMNSCNGMPGSTGR------RGRQTYTRFQTLELEKEFHFN 169

  Fly    66 KYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK 100
            :||.|.||||||..|.|||||:||||||||||.||
Zfish   170 RYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/52 (65%)
hoxb6bNP_571613.1 Antp-type hexapeptide 129..134 2/4 (50%)
Homeobox 151..203 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.