DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and hoxa1a

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_571611.1 Gene:hoxa1a / 58051 ZFINID:ZDB-GENE-000823-5 Length:329 Species:Danio rerio


Alignment Length:130 Identity:53/130 - (40%)
Similarity:66/130 - (50%) Gaps:27/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CVELNVEAAPTATTRSSEKSKRS-------------------RTAFSSLQLIELEREFHLNKYLA 69
            |..|: :..||..|....|.||:                   ||.||:.||.|||:|||.||||.
Zfish   188 CSPLS-DGVPTGQTFDWMKVKRNPPKTGKAGEYGFGGQPNTVRTNFSTKQLTELEKEFHFNKYLT 251

  Fly    70 RTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDDQIVER 134
            |.||:||:..|.|.|.||||||||||||.||....    |.|..|:   |:..:.|:|.:...|:
Zfish   252 RARRVEIAASLQLNETQVKIWFQNRRMKQKKREKE----GLLPKSL---SEQKDGLEKTEDASEK 309

  Fly   135  134
            Zfish   310  309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/71 (51%)
hoxa1aNP_571611.1 Antp-type hexapeptide 200..205 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..227 1/18 (6%)
Homeobox 229..281 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..329 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.